Skip to main content

New Drug Approvals 2014 - Pt. V - Metreleptin (MyaleptTM)



ATC Code (s): A08A, A10X, A16A
Wikipedia: Metreleptin

On February 24th 2014, the FDA approved metreleptin (Tradename: Myalept), a leptin analogue, as an adjunct to diet and replacement therapy, for the treatment of complications associated with leptin deficiency in patients with congenital or acquired generalized lipodystrophy.

Lipodystrophy is a rare condition characterized by abnormalities in adipose (fat) tissue distribution. It can be congenital, i.e. the patient is born with little or no adipose tissue, or it can be acquired, for example, after prolonged antiretroviral drug therapy some patients keep on losing adipose tissue with time. The deficiency of adipose tissue leads to hypertriglyceridemia and ectopic deposition of fat in non-adipose tissues such as liver and muscle, contributing to metabolic abnormalities including insulin resistance.

Leptin is an endogenous hormone, predominantly secreted in the adipose tissue, responsible to signal to the central nervous system, the status of energy stores in the body. In patients with lipodystrophy, the levels of this hormone are lower, resulting in excess caloric intake, which exacerbates the metabolic abnormalities.

Metreleptin is a recombinant human leptin analogue, which exert its function by binding to and activating the human leptin receptor. This increases insulin sensitivity and reduces food intake, soothing the metabolic abnormalities of patients with lipodystrophy.

Leptin receptor (Uniprot accession: P48357; ChEMBL ID: CHEMBL5913) is a member of the cytokine family class I, which signals through the JAK/STAT transduction pathway. Currently, there is one crystal structure of the human leptin receptor in complex with an antibody (PDBe: 3v6o). The structure is shown bellow, and the leptin receptor is depicted in green.


The -leptin USAN/INN stem covers leptin derivatives. Metreleptin is the first approved drug of its class, and the only member so far. In Japan, metreleptin was approved on May 25 th 2013 for the treatment of metabolic disorders, including lipodystrophy (see PMID: 23740412).

Metreleptin (ChEMBL: CHEMBL2107857) is a recombinant human leptin analog produced in E. coli and differs from native human leptin by the addition of a methionine residue at its amino terminus. Metreleptin is a 147-amino acid, nonglycosylated, polypeptide with one disulfide bond between Cys-97 and Cys-147 and a molecular weight of approximately 16.15 kDa.

>Metreleptin
MVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLA
VYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGY
STEVVALSRLQGSLQDMLWQLDLSPGC

Metreleptin is available as a lyophilized cake, which is later reconstituted with bacteriostatic or preservative-free sterile water, for subcutaneous injection. The recommended starting daily dose is 0.06 mg/kg in patients weighting less than 40 kg, 2.5 mg in male patients weighting more than 40Kg, and 5 mg in female patients weighting more than 40 kg, with a respective maximum daily dose of 0.13 mg/kg, 10 mg and 10 mg. In healthy subjects, the peak serum concentration (Cmax) of leptin is reached at 4.0 to 4.3 hours after subcutaneous administration of single doses ranging from 0.1 to 0.3 mg/kg, and following intravenous administration of metreleptin, leptin volume of distribution is 370 ± 184 mL/kg for a dose of 0.3 mg/kg/day. Metreleptin bioavailability is not influence by food intake, hence it can be administered without regard to the timing of meals.

No formal metabolism studies have been conducted with metreleptin, however, nonclinical data indicates renal clearance is the major route of metreleptin elimination, with no apparent contribution of systemic metabolism or degradation. In healthy subjects, following single subcutaneous doses of 0.01 to 0.3 mg/mL, the half-life t1/2 of metreleptin is 3.8 to 4.7 hours.

Metreleptin has been approved with a black box warning due to the risks associated with the development of antimetreleptin antibodies that neutralize endogenous leptin and/or metreleptin and the risk for T-cell lymphoma. Consequently, metreleptin is only available through the Myalept Risk Evaluation and Mitigation Strategy (REMS) Program.

The license holder for MyaleptTM is Amylin Pharmaceuticals, a subsidiary of Bristol-Myers Squibb, and the full prescribing information can be found here.

Comments

Popular posts from this blog

ChEMBL 34 is out!

We are delighted to announce the release of ChEMBL 34, which includes a full update to drug and clinical candidate drug data. This version of the database, prepared on 28/03/2024 contains:         2,431,025 compounds (of which 2,409,270 have mol files)         3,106,257 compound records (non-unique compounds)         20,772,701 activities         1,644,390 assays         15,598 targets         89,892 documents Data can be downloaded from the ChEMBL FTP site:  https://ftp.ebi.ac.uk/pub/databases/chembl/ChEMBLdb/releases/chembl_34/ Please see ChEMBL_34 release notes for full details of all changes in this release:  https://ftp.ebi.ac.uk/pub/databases/chembl/ChEMBLdb/releases/chembl_34/chembl_34_release_notes.txt New Data Sources European Medicines Agency (src_id = 66): European Medicines Agency's data correspond to EMA drugs prior to 20 January 2023 (excluding vaccines). 71 out of the 882 newly added EMA drugs are only authorised by EMA, rather than from other regulatory bodies e.g.

New SureChEMBL announcement

(Generated with DALL-E 3 ∙ 30 October 2023 at 1:48 pm) We have some very exciting news to report: the new SureChEMBL is now available! Hooray! What is SureChEMBL, you may ask. Good question! In our portfolio of chemical biology services, alongside our established database of bioactivity data for drug-like molecules ChEMBL , our dictionary of annotated small molecule entities ChEBI , and our compound cross-referencing system UniChem , we also deliver a database of annotated patents! Almost 10 years ago , EMBL-EBI acquired the SureChem system of chemically annotated patents and made this freely accessible in the public domain as SureChEMBL. Since then, our team has continued to maintain and deliver SureChEMBL. However, this has become increasingly challenging due to the complexities of the underlying codebase. We were awarded a Wellcome Trust grant in 2021 to completely overhaul SureChEMBL, with a new UI, backend infrastructure, and new f

Accessing SureChEMBL data in bulk

It is the peak of the summer (at least in this hemisphere) and many of our readers/users will be on holiday, perhaps on an island enjoying the sea. Luckily, for the rest of us there is still the 'sea' of SureChEMBL data that awaits to be enjoyed and explored for hidden 'treasures' (let me know if I pushed this analogy too far). See here and  here for a reminder of SureChEMBL is and what it does.  This wealth of (big) data can be accessed via the SureChEMBL interface , where users can submit quite sophisticated and granular queries by combining: i) Lucene fields against full-text and bibliographic metadata and ii) advanced structure query features against the annotated compound corpus. Examples of such queries will be the topic of a future post. Once the search results are back, users can browse through and export the chemistry from the patent(s) of interest. In addition to this functionality, we've been receiving user requests for  local (behind the

Mapping lists of IDs in ChEMBL

In order to facilitate the mapping of identifiers in ChEMBL, we have developed a new type of search in the ChEMBL Interface. Now, it is possible to enter a list of ChEMBL IDs and see a list of the corresponding entities. Here is an example: 1. Open the ChEMBL Interface , on the main search bar, click on 'Advanced Search': 2. Click on the 'Search by IDs' tab: 3. Select the source entity of the IDs and the destination entity that you want to map to: 4. Enter the identifiers, you can either paste them, or select a file to upload. When you paste IDs, by default it tries to detect the separator. You can also select from a list of separators to force a specific one: Alternatively, you can upload a file, the file can be compressed in GZIP and ZIP formats, this makes the transfer of the file to the ChEMBL servers faster. Examples of the files that can be uploaded to the search by IDs can be found  here . 5. Click on the search button: 6. You will be redirected to a search resul

A python client for accessing ChEMBL web services

Motivation The CheMBL Web Services provide simple reliable programmatic access to the data stored in ChEMBL database. RESTful API approaches are quite easy to master in most languages but still require writing a few lines of code. Additionally, it can be a challenging task to write a nontrivial application using REST without any examples. These factors were the motivation for us to write a small client library for accessing web services from Python. Why Python? We choose this language because Python has become extremely popular (and still growing in use) in scientific applications; there are several Open Source chemical toolkits available in this language, and so the wealth of ChEMBL resources and functionality of those toolkits can be easily combined. Moreover, Python is a very web-friendly language and we wanted to show how easy complex resource acquisition can be expressed in Python. Reinventing the wheel? There are already some libraries providing access to ChEMBL d